Structure of PDB 5otv Chain A Binding Site BS01

Receptor Information
>5otv Chain A (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEP
GSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECE
ES
Ligand information
>5otv Chain B (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HCEGMFTSDVSSYLEGQAAKEFIAWLVKG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5otv alpha-Helix or beta-Turn? An Investigation into N-Terminally Constrained Analogues of Glucagon-like Peptide 1 (GLP-1) and Exendin-4.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		T29 L32 T35 W39 E68 Y69 Y88 L123 E128
Binding residue
(residue number reindexed from 1)		T2 L5 T8 W12 E41 Y42 Y61 L96 E101
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004967 glucagon receptor activity
GO:0008528 G protein-coupled peptide receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5otv, PDBe:5otv, PDBj:5otv
PDBsum5otv
PubMed29877701
UniProtP43220|GLP1R_HUMAN Glucagon-like peptide 1 receptor (Gene Name=GLP1R)

[Back to BioLiP]