Structure of PDB 5ons Chain A Binding Site BS01

Receptor Information
>5ons Chain A (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPV
KIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKG
AIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKM
SAEDIEKVNKGIGIENIHYLNDGLWHMKTYK
Ligand information
>5ons Chain B (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ADYPLRVLYCGVCSLPTEYCEYMP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ons DENR-MCTS1 heterodimerization and tRNA recruitment are required for translation reinitiation.
Resolution2.14 Å
Binding residue
(original residue number in PDB)		W39 Q42 H86 K87 Y88 P89 F90 I102 K139 Q140 H141 L143 L170 N171 W175 K178
Binding residue
(residue number reindexed from 1)		W39 Q42 H86 K87 Y88 P89 F90 I102 K139 Q140 H141 L143 L170 N171 W175 K178
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000339 RNA cap binding
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0043024 ribosomal small subunit binding
GO:0045183 translation factor activity, non-nucleic acid binding
Biological Process
GO:0001731 formation of translation preinitiation complex
GO:0002188 translation reinitiation
GO:0006412 translation
GO:0006413 translational initiation
GO:0006417 regulation of translation
GO:0006974 DNA damage response
GO:0032790 ribosome disassembly
GO:0075522 IRES-dependent viral translational initiation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ons, PDBe:5ons, PDBj:5ons
PDBsum5ons
PubMed29889857
UniProtQ9ULC4|MCTS1_HUMAN Malignant T-cell-amplified sequence 1 (Gene Name=MCTS1)

[Back to BioLiP]