Structure of PDB 5onb Chain A Binding Site BS01

Receptor Information
>5onb Chain A (length=270) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLEREKIYQWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAA
LLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHI
PLFLYPFLHTVSKTRPFEYLRLTSLGVIGALVKTDEQEVINFLLTTEIIP
LCLRIMESGSELSKTVATFILQKILLDDTGLAYICQTYERFSHVAMILGK
MVLQLSKEPSARLLKHVVRCYLRLSDNPRAREALRQCLPDQLKDTTFAQV
LKDDTTTKRWLAQLVKNLQE
Ligand information
>5onb Chain B (length=22) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DDQQLDHNFKQMEEHLALMVEG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5onb DrosophilaBag-of-marbles directly interacts with the CAF40 subunit of the CCR4-NOT complex to elicit repression of mRNA targets.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R46 E47 A84 H85 N88 Q98 R130 E133 Y134 L137 T138 G141 G144 K148 L177 F184 K230
Binding residue
(residue number reindexed from 1)		R31 E32 A69 H70 N73 Q83 R115 E118 Y119 L122 T123 G126 G129 K133 L162 F169 K215
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006402 mRNA catabolic process
Cellular Component
GO:0030014 CCR4-NOT complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5onb, PDBe:5onb, PDBj:5onb
PDBsum5onb
PubMed29255063
UniProtQ92600|CNOT9_HUMAN CCR4-NOT transcription complex subunit 9 (Gene Name=CNOT9)

[Back to BioLiP]