Structure of PDB 5ok6 Chain A Binding Site BS01

Receptor Information

>5ok6 Chain A (length=219) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HEELPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGGD
QDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYG
LEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFSHTDSI
GLVLRTARERFLVEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQL
IIMETRKKDGTWPSAQLEH

Ligand information

>5ok6 Chain D (length=12) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GEFYKLKIRTPR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5ok6 Discovery of peptide ligands targeting a specific ubiquitin-like domain-binding site in the deubiquitinase USP11.
Resolution	1.3 Å
Binding residue (original residue number in PDB)	H161 W200 N203 S207 L208 D209 L245 E246 H247
Binding residue (residue number reindexed from 1)	H133 W172 N175 S179 L180 D181 L217 E218 H219

Enzymatic activity

Enzyme Commision number

3.4.19.12: ubiquitinyl hydrolase 1.

Gene Ontology

	Molecular Function
GO:0004843	cysteine-type deubiquitinase activity

View graph for
Molecular Function

External links

PDB	RCSB:5ok6, PDBe:5ok6, PDBj:5ok6
PDBsum	5ok6
PubMed	30373771
UniProt	P51784\|UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 (Gene Name=USP11)

[Back to BioLiP]