Structure of PDB 5ojr Chain A Binding Site BS01

Receptor Information
>5ojr Chain A (length=308) Species: 146786 (Thermosynechococcus vestitus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HGLVPRGSIPALDYNPWEAIQLPTTATILDMSFIDRHHGWLVGVNATLME
TRDGGQTWEPRTLVLDHSDYRFNSVSFQGNEGWIVGEPPIMLHTTDGGQS
WSQIPLDPKLPGSPRLIKALGNGSAEMITNVGAIYRTKDSGKNWQALVQE
AIGVMRNLNRSPSGEYVAVSSRGSFYSTWEPGQTAWEPHNRTTSRRLHNM
GFTPDGRLWMIVNGGKIAFSDPDNSENWGELLSPLRVGFLDLAYRTPNEV
WLAGGAGALLCSQDGGQTWQQDVDVKKVPSNFYKILFFSPDQGFILGQKG
ILLRYVTD
Ligand information
>5ojr Chain E (length=18) Species: 146786 (Thermosynechococcus vestitus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NAHNFPLDLASAESAPVA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ojr Ycf48 involved in the biogenesis of the oxygen-evolving photosystem II complex is a seven-bladed beta-propeller protein.
Resolution1.96 Å
Binding residue
(original residue number in PDB)
L93 V94 S130 W131 S132 Q133 I134 P135 D137 P141 V161 A163 Y165 G171 K172 W174 Q175 A176 Q179 E180 A181 I182
Binding residue
(residue number reindexed from 1)
L63 V64 S100 W101 S102 Q103 I104 P105 D107 P111 V131 A133 Y135 G141 K142 W144 Q145 A146 Q149 E150 A151 I152
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0031977 thylakoid lumen
GO:0031979 plasma membrane-derived thylakoid lumen

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5ojr, PDBe:5ojr, PDBj:5ojr
PDBsum5ojr
PubMed30061392
UniProtQ8DI95|YCF48_THEVB Photosystem II assembly protein Ycf48 (Gene Name=ycf48)

[Back to BioLiP]