Structure of PDB 5od6 Chain A Binding Site BS01

Receptor Information
>5od6 Chain A (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQN
VNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELC
EFAFNMKKDEVCVNPYHYQRVETPV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5od6 Structural basis for genome wide recognition of 5-bp GC motifs by SMAD transcription factors.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		L71 Q76 V77 S78 K81
Binding residue
(residue number reindexed from 1)		L62 Q67 V68 S69 K72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005667 transcription regulator complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5od6, PDBe:5od6, PDBj:5od6
PDBsum5od6
PubMed29234012
UniProtP84022|SMAD3_HUMAN Mothers against decapentaplegic homolog 3 (Gene Name=SMAD3)

[Back to BioLiP]