Structure of PDB 5oc6 Chain A Binding Site BS01

Receptor Information
>5oc6 Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVIKMAVKFDRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFS
SIVTVAEQKYQSTLWDKSKKLAEQAAAIVCLRSQGLPEGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5oc6 Molecular basis for transfer RNA recognition by the double-stranded RNA-binding domain of human dihydrouridine synthase 2.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Q367 E376 R379 S418
Binding residue
(residue number reindexed from 1)		Q17 E26 R29 S68
Enzymatic activity
Enzyme Commision number 1.3.1.91: tRNA-dihydrouridine(20) synthase [NAD(P)(+)].
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5oc6, PDBe:5oc6, PDBj:5oc6
PDBsum5oc6
PubMed30605527
UniProtQ9NX74|DUS2L_HUMAN tRNA-dihydrouridine(20) synthase [NAD(P)+]-like (Gene Name=DUS2)

[Back to BioLiP]