Structure of PDB 5oav Chain A Binding Site BS01

Receptor Information

>5oav Chain A (length=57) Species: 9031 (Gallus gallus)

TFVALYDYVSRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPS
NYVAPSD

Ligand information

>5oav Chain B (length=7) Species: 32630 (synthetic construct)

APPLPPR

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5oav High resolution crystal structure of the c-Src-SH3 domain mutant E93V in complex with the high affinity synthetic peptide APP12: monoclinic crystal
• Resolution: 0.95 Å
• Binding residue (original residue number in PDB): Y90 Y92 R95 D99 D117 W118 P133 N135 Y136
• Binding residue (residue number reindexed from 1): Y6 Y8 R11 D15 D33 W34 P49 N51 Y52

Enzymatic activity

• Enzyme Commision number: 2.7.10.2: non-specific protein-tyrosine kinase.

External links

• PDB: RCSB:5oav, PDBe:5oav, PDBj:5oav
• PDBsum: 5oav
• UniProt: P00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)