Structure of PDB 5oak Chain A Binding Site BS01

Receptor Information
>5oak Chain A (length=90) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMGDGEMLLIINEYGSPLGLTALPDKEHGGGLLVQHVEPGSRAERGRLRR
DDRILEINGIKLIGLTESQVQEQLRRALESSELRVRVLRG
Ligand information
>5oak Chain B (length=11) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSGVKDGVLHL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5oak Structural basis for the interaction between the cell polarity proteins Par3 and Par6.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		P18 L19 L21 T22 A23 P25 L75 R76
Binding residue
(residue number reindexed from 1)		P17 L18 L20 T21 A22 P24 L74 R75
Enzymatic activity
Enzyme Commision number ?
External links