Structure of PDB 5o20 Chain A Binding Site BS01

Receptor Information
>5o20 Chain A (length=162) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NHHLYPDELNVSNNPHYRPKPVSYDSTLPPDHIKVYSRTLFIGGVPLNMK
EWDLANVLKPFAEVQSVILNNSRKHAFVKVYSRHEAENVLQNFNKDGALP
LRTRWGVGFGPRDCCDYQHGYSIIPMHRLTDADKKWSVSAQWGGTSGQPL
VTGIVFEEPDII
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5o20 The structure of transcription termination factor Nrd1 reveals an original mode for GUAA recognition.
Resolution3.53 Å
Binding residue
(original residue number in PDB)		F342 G344 G345 I369 K375 H376 F378 R403 R405 W406 R413 Y418
Binding residue
(residue number reindexed from 1)		F41 G43 G44 I68 K74 H75 F77 R102 R104 W105 R112 Y117
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5o20, PDBe:5o20, PDBj:5o20
PDBsum5o20
PubMed28973465
UniProtP53617|NRD1_YEAST Protein NRD1 (Gene Name=NRD1)

[Back to BioLiP]