Structure of PDB 5o1y Chain A Binding Site BS01

Receptor Information
>5o1y Chain A (length=163) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NHHLYPDELNVSNNPHYRPKPVSYDSTLPPDHIKVYSRTLFIGGVPLNMK
EWDLANVLKPFAEVQSVILNNSRKHAFVKVYSRHEAENVLQNFNKDGALP
LRTRWGVGFGPRDCCDYQHGYSIIPMHRLTDADKKWSVSAQWGGTSGQPL
VTGIVFEEPDIIV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5o1y The structure of transcription termination factor Nrd1 reveals an original mode for GUAA recognition.
Resolution2.45 Å
Binding residue
(original residue number in PDB)		F342 G344 H376 F378 R403 R405 W406 G409 R413 V464
Binding residue
(residue number reindexed from 1)		F41 G43 H75 F77 R102 R104 W105 G108 R112 V163
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5o1y, PDBe:5o1y, PDBj:5o1y
PDBsum5o1y
PubMed28973465
UniProtP53617|NRD1_YEAST Protein NRD1 (Gene Name=NRD1)

[Back to BioLiP]