Structure of PDB 5nsc Chain A Binding Site BS01

Receptor Information
>5nsc Chain A (length=209) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH
NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT
ISKAKGQPREPQVYTKPPSREEMTKNQVSLKCLVKGFYPSDIAVEWESNG
QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH
YTQKSLSLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nsc A new approach for generating bispecific antibodies based on a common light chain format and the stable architecture of human immunoglobulin G1.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		L251 M252 I253 S254 Q311 E380 G385 M428 H433 N434 H435 Y436
Binding residue
(residue number reindexed from 1)		L16 M17 I18 S19 Q76 E145 G150 M193 H198 N199 H200 Y201
Enzymatic activity
Enzyme Commision number ?
External links