Structure of PDB 5ns4 Chain A Binding Site BS01

Receptor Information
>5ns4 Chain A (length=138) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLILEKAAQELA
LITGQKPAVTRAGMPIGLRVTLRRDRMWIFLEKLLNVALPGLNPNSFDGR
GNYNLGLREQGMDIAVVTTAETDEEARALLELLGFPFR
Ligand information
>5ns4 Chain C (length=32) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugcaccugaccccaugccgaacucagagugca
<<<<<<<<...............>>>.>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ns4 Crystal Structures of Cyanine Fluorophores Stacked onto the End of Double-Stranded RNA.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		K36 V38 N40 I88 R91 S124 F125 D126 R128 N132 G134 R136 D156 A158
Binding residue
(residue number reindexed from 1)		K33 V35 N37 I66 R69 S96 F97 D98 R100 N104 G106 R108 D113 A115
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ns4, PDBe:5ns4, PDBj:5ns4
PDBsum5ns4
PubMed29211987
UniProtP41201|RL5_THETH Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]