Structure of PDB 5nq3 Chain A Binding Site BS01

Receptor Information
>5nq3 Chain A (length=276) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGPHSLSYFSTAVSRPDRGDSRFIAVGYVDDTQFVRFDSDAPNPRMEPRA
PWIQQEGQEYWDRNTRNVMGSAQINRVNLKTLRGYYNQSEAGSHTLQWMY
GCYLGPDGLLLRGYDQFAYDGADYLALNEDLRSWTAADMAAQISKRKWEA
ADAAEHWRSYLQGTCVESLRRYLQMGKDTLQRAEPPKTHVTRHPSSDLGV
TLRCWALGFHPKEISLTWQREGQDQSQDMELVETRPSGDGTFQKWAALVV
PPGEEQSYTCHVQHEGLQEPLTLRWD
Ligand information
>5nq3 Chain C (length=9) Species: 11309 (unidentified influenza virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EFEDLTFLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nq3 Induction of influenza-specific local CD8 T-cells in the respiratory tract after aerosol delivery of vaccine antigen or virus in the Babraham inbred pig.
Resolution1.57 Å
Binding residue
(original residue number in PDB)		Y8 R63 N64 N67 S71 I74 N78 Y85 W98 Y100 S144 K147 W148 A153 Y160 T164 S168 Y172
Binding residue
(residue number reindexed from 1)		Y8 R63 N64 N67 S71 I74 N78 Y85 W98 Y100 S144 K147 W148 A153 Y160 T164 S168 Y172
Enzymatic activity
Enzyme Commision number ?
External links