Structure of PDB 5nq2 Chain A Binding Site BS01

Receptor Information
>5nq2 Chain A (length=277) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGPHSLSYFYTAVSRPDRGEPRFIAVGYVDDTQFVRFDSDAPNPRMEPRA
PWIQQEGQDYWDRETQIQRDNAQTFRVNLRTALGYYNQSEAGSHTFQSMY
GCYLGPDGLLLRGYSQYGYDSADYIALNEDLRSWTAADTAAQITKRKWEA
ADEAEQWRSYLQGLCVEGLRRYLEMGKDTLQRAEPPKTHVTRHPSSDLGV
TLRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGTFQKWAALVV
PPGEEQSYTCHVQHEGLQEPLTLRWDP
Ligand information
>5nq2 Chain C (length=9) Species: 11309 (unidentified influenza virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IAYERMCNI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nq2 Induction of influenza-specific local CD8 T-cells in the respiratory tract after aerosol delivery of vaccine antigen or virus in the Babraham inbred pig.
Resolution1.54 Å
Binding residue
(original residue number in PDB)		Y8 E64 N78 Y85 Y100 Y117 T144 K147 W148 W157 Y160 Y172
Binding residue
(residue number reindexed from 1)		Y8 E64 N78 Y85 Y100 Y117 T144 K147 W148 W157 Y160 Y172
Enzymatic activity
Enzyme Commision number ?
External links