Structure of PDB 5nq0 Chain A Binding Site BS01

Receptor Information
>5nq0 Chain A (length=275) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLSYFSTAVSRPDRGDSRFIAVGYVDDTQFVRFDSDAPNPRMEPRAP
WIQQEGQEYWDRNTRNVMGSAQINRVNLKTLRGYYNQSEAGSHTLQWMYG
CYLGPDGLLLRGYDQFAYDGADYLALNEDLRSWTAADMAAQISKRKWEAA
DAAEHWRSYLQGTCVESLRRYLQMGKDTLQRAEPPKTHVTRHPSSDLGVT
LRCWALGFHPKEISLTWQREGQDQSQDMELVETRPSGDGTFQKWAALVVP
PGEEQSYTCHVQHEGLQEPLTLRWD
Ligand information
>5nq0 Chain C (length=9) Species: 11309 (unidentified influenza virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DFEREGYSL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nq0 Induction of influenza-specific local CD8 T-cells in the respiratory tract after aerosol delivery of vaccine antigen or virus in the Babraham inbred pig.
Resolution1.1 Å
Binding residue
(original residue number in PDB)		Y8 M46 R63 N64 N67 V68 S71 I74 N78 Y85 Y100 S144 K147 W148 A151 A153 H156 W157 Y160 S168 Y172
Binding residue
(residue number reindexed from 1)		Y7 M45 R62 N63 N66 V67 S70 I73 N77 Y84 Y99 S143 K146 W147 A150 A152 H155 W156 Y159 S167 Y171
Enzymatic activity
Enzyme Commision number ?
External links