Structure of PDB 5npi Chain A Binding Site BS01

Receptor Information
>5npi Chain A (length=232) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLQQSGPELVKPGASLKISCKTSGYTFTDFTFHWVKLSHGPSLEWIGT
IKPSNGDTAYNQKFKGKATLSVDKSASTAHIEFRSLTSEDSAVYFCARFG
GSYPYAMDYWGQGTSVIVSSGTASDIVLTQSPATLSVTPGDRVSLSCRAS
QGIYNYVHWFQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSIN
SVESEDFGMYFCQQTNKWPLTFGAGTKLELKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5npi Conformational Flexibility in the Immunoglobulin-Like Domain of the Hepatitis C Virus Glycoprotein E2.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		T33 K52 D57 T58 Y105 Y172 T231 N232 K233 W234
Binding residue
(residue number reindexed from 1)		T33 K52 D57 T58 Y105 Y156 T215 N216 K217 W218
External links