Structure of PDB 5nnx Chain A Binding Site BS01

Receptor Information
>5nnx Chain A (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLR
TGKTRTRKQVSSHIQVLARRKSRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nnx TEAD1 bound to DNA
Resolution3.29 Å
Binding residue
(original residue number in PDB)		K88 S92 R100
Binding residue
(residue number reindexed from 1)		K58 S62 R70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5nnx, PDBe:5nnx, PDBj:5nnx
PDBsum5nnx
PubMed
UniProtP28347|TEAD1_HUMAN Transcriptional enhancer factor TEF-1 (Gene Name=TEAD1)

[Back to BioLiP]