Structure of PDB 5nl1 Chain A Binding Site BS01

Receptor Information
>5nl1 Chain A (length=141) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMD
ESKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEM
SRGVKLLAALLEDEGGNGRPLLQAAKGLAGAVSELLRSAQP
Ligand information
>5nl1 Chain H (length=23) Species: 623 (Shigella flexneri) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RETIFEASKKVTNSLSNLISLIG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nl1 Shigella IpaA Binding to Talin Stimulates Filopodial Capture and Cell Adhesion.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		K540 V547 V558 T561 P607 A611 L615 A618 E621 S625
Binding residue
(residue number reindexed from 1)		K53 V60 V71 T74 P120 A124 L128 A131 E134 S138
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005200 structural constituent of cytoskeleton
Cellular Component
GO:0001726 ruffle
GO:0005925 focal adhesion

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5nl1, PDBe:5nl1, PDBj:5nl1
PDBsum5nl1
PubMed30673614
UniProtP26039|TLN1_MOUSE Talin-1 (Gene Name=Tln1)

[Back to BioLiP]