Structure of PDB 5njj Chain A Binding Site BS01

Receptor Information
>5njj Chain A (length=143) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERKFFKGFF
GKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRA
FSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5njj A Numb-Mdm2 fuzzy complex reveals an isoform-specific involvement of Numb in breast cancer.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
A163 L166
Binding residue
(residue number reindexed from 1)
A137 L140
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5njj, PDBe:5njj, PDBj:5njj
PDBsum5njj
PubMed29269425
UniProtP49757|NUMB_HUMAN Protein numb homolog (Gene Name=NUMB)

[Back to BioLiP]