Structure of PDB 5nj8 Chain A Binding Site BS01

Receptor Information

>5nj8 Chain A (length=176) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFF
DVALKGLNLQEGEFLLQALNGFVLVVTTDALVFYASSTIQDYLGFQQSDV
IHQSVYELIHTEDRAEFQRQLHWPPENSPLMERCFICRLRCLLDSSGFLA
MNFQGKLKYLHGQKPQLALFAIATPL

Ligand information

>5nj8 Chain E (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggtcacgcaacc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5nj8 Structural Basis for Aryl Hydrocarbon Receptor-Mediated Gene Activation.
Resolution	3.3 Å
Binding residue (original residue number in PDB)	R40 D65 K66
Binding residue (residue number reindexed from 1)	R7 D32 K33
Binding affinity	PDBbind-CN: Kd=90nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0046983	protein dimerization activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006805	xenobiotic metabolic process
GO:0009410	response to xenobiotic stimulus

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5nj8, PDBe:5nj8, PDBj:5nj8
PDBsum	5nj8
PubMed	28602820
UniProt	P35869\|AHR_HUMAN Aryl hydrocarbon receptor (Gene Name=AHR)

[Back to BioLiP]