Structure of PDB 5nht Chain A Binding Site BS01

Receptor Information

>5nht Chain A (length=197) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMSIYS
NGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVGGGADGLTFGK
GTHLIIQPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDV
YITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP

Ligand information

>5nht Chain P (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ELAGIGILTV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5nht human 199.54-16 TCR in complex with Melan-A/MART-1 (26-35) peptide and HLA-A2
Resolution	3.2 Å
Binding residue (original residue number in PDB)	Q31 G93
Binding residue (residue number reindexed from 1)	Q29 G91

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0042605	peptide antigen binding

	Biological Process
GO:0002250	adaptive immune response

	Cellular Component
GO:0005886	plasma membrane
GO:0042101	T cell receptor complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5nht, PDBe:5nht, PDBj:5nht
PDBsum	5nht
PubMed
UniProt	A0A075B6T6\|TVAL2_HUMAN T cell receptor alpha variable 12-2 (Gene Name=TRAV12-2); K7N5N2

[Back to BioLiP]