Structure of PDB 5nd0 Chain A Binding Site BS01

Receptor Information
>5nd0 Chain A (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRK
IQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFAS
AMMHALEVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nd0 Designed nanomolar small-molecule inhibitors of Ena/VASP EVH1 interaction impair invasion and extravasation of breast cancer cells.
Resolution1.45 Å
Binding residue
(original residue number in PDB)
Y16 K22 W23 K69 F77 Q79 R81
Binding residue
(residue number reindexed from 1)
Y14 K20 W21 K67 F75 Q77 R79
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5nd0, PDBe:5nd0, PDBj:5nd0
PDBsum5nd0
PubMed33184177
UniProtQ8N8S7|ENAH_HUMAN Protein enabled homolog (Gene Name=ENAH)

[Back to BioLiP]