Structure of PDB 5n91 Chain A Binding Site BS01

Receptor Information
>5n91 Chain A (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRV
VGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDAN
VFASAMMHALEVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5n91 Designed nanomolar small-molecule inhibitors of Ena/VASP EVH1 interaction impair invasion and extravasation of breast cancer cells.
Resolution1.49 Å
Binding residue
(original residue number in PDB)
Y16 W23 K69 F77 Q79 R81
Binding residue
(residue number reindexed from 1)
Y18 W25 K71 F79 Q81 R83
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5n91, PDBe:5n91, PDBj:5n91
PDBsum5n91
PubMed33184177
UniProtQ8N8S7|ENAH_HUMAN Protein enabled homolog (Gene Name=ENAH)

[Back to BioLiP]