Structure of PDB 5n8t Chain A Binding Site BS01

Receptor Information

>5n8t Chain A (length=120) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAP
ATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGT
TEANAWKSTLVGHDTFTKVK

Ligand information

>5n8t Chain B (length=9) Species: 1895 (Streptomyces avidinii) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LWQHEATWK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5n8t Stepwise Evolution Improves Identification of Diverse Peptides Binding to a Protein Target.
Resolution	1.61 Å
Binding residue (original residue number in PDB)	S27 Y43 S52 Y54 W79 R84 N85 A86 S88 T90 W92 W108
Binding residue (residue number reindexed from 1)	S13 Y29 S38 Y40 W65 R70 N71 A72 S74 T76 W78 W94

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0009374	biotin binding

View graph for
Molecular Function

External links

PDB	RCSB:5n8t, PDBe:5n8t, PDBj:5n8t
PDBsum	5n8t
PubMed	28935886
UniProt	P22629\|SAV_STRAV Streptavidin

[Back to BioLiP]