Structure of PDB 5n8b Chain A Binding Site BS01

Receptor Information
>5n8b Chain A (length=121) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAP
ATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGT
TEANAWKSTLVGHDTFTKVKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5n8b Stepwise Evolution Improves Identification of Diverse Peptides Binding to a Protein Target.
Resolution1.03 Å
Binding residue
(original residue number in PDB)		L25 S27 Y43 S45 S52 Y54 W79 R84 A86 S88 T90 W108 L110 S112 L124 D128
Binding residue
(residue number reindexed from 1)		L11 S13 Y29 S31 S38 Y40 W65 R70 A72 S74 T76 W94 L96 S98 L110 D114
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5n8b, PDBe:5n8b, PDBj:5n8b
PDBsum5n8b
PubMed28935886
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]