Structure of PDB 5n8a Chain A Binding Site BS01

Receptor Information
>5n8a Chain A (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDG
LNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMEL
EVLKSAEAVGVKIGNPVPYNE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5n8a Molecular basis for PrimPol recruitment to replication forks by RPA.
Resolution1.28 Å
Binding residue
(original residue number in PDB)		R31 I33 T34 R43 M57 L87 R91
Binding residue
(residue number reindexed from 1)		R32 I34 T35 R44 M58 L88 R92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006260 DNA replication
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5n8a, PDBe:5n8a, PDBj:5n8a
PDBsum5n8a
PubMed28534480
UniProtP27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit (Gene Name=RPA1)

[Back to BioLiP]