Structure of PDB 5n1w Chain A Binding Site BS01

Receptor Information
>5n1w Chain A (length=170) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKERVITEFWDGKIIMVSPDDPKYALKKAEEVRELVDSELGFQQVSLRCP
SQTRTYMFVSNEKKIVGCLIAEPIREAYRVLAEPPSLHRAWRCSTEPEPA
ICGISRIWVFALMRRKAIASRMVDAVRSSFMYGSVLTTEEIAFSDPTPDG
KLFASTYCKVPDFLVYNFVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5n1w Structural Basis of Eco1-Mediated Cohesin Acetylation.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
S676 D677 P678 N699 F700 V701
Binding residue
(residue number reindexed from 1)
S144 D145 P146 N167 F168 V169
Enzymatic activity
Enzyme Commision number ?
External links