Structure of PDB 5mu3 Chain A Binding Site BS01

Receptor Information
>5mu3 Chain A (length=184) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATDFVQWENSVRLIGVSLFPVNYDNIEFMGIRLELFDELSLKYDPPFYVI
LKPSVKRLGIWELFKHNLPKYINIHQHWQLITKDTDTSDSNIMKFANLCY
KDLLKVHSRVQFFRKLEGNYVNDKQYSLLHIDNMGLNVSFRLGADIIKIK
VDDGDDEIIDCTFNGEKNISLLGSIYGITNRFQS
Ligand information
>5mu3 Chain C (length=24) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NEIYQQDKIDFNLKLKTDFSKPLI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mu3 Molecular basis for inner kinetochore configuration through RWD domain-peptide interactions.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		L186 K200 K207
Binding residue
(residue number reindexed from 1)		L80 K94 K101
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0034508 centromere complex assembly
Cellular Component
GO:0000776 kinetochore

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mu3, PDBe:5mu3, PDBj:5mu3
PDBsum5mu3
PubMed29046335
UniProtQ6CVQ9|CENPO_KLULA Inner kinetochore subunit MCM21 (Gene Name=MCM21)

[Back to BioLiP]