Structure of PDB 5mtf Chain A Binding Site BS01

Receptor Information

>5mtf Chain A (length=181) Species: 585035 (Escherichia coli S88)

ERAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFT
HALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQ
KFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG
WFDLFGMSMANGAHIAGLAVGLAMAFVDSLN

Ligand information

>5mtf Chain C (length=5) Species: 32630 (synthetic construct)

RVRHt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5mtf General and Modular Strategy for Designing Potent, Selective, and Pharmacologically Compliant Inhibitors of Rhomboid Proteases.
• Resolution: 1.79 Å
• Binding residue (original residue number in PDB): M120 F146 H150 F153 N154 W196 F197 G198 G199 S201 W236 M247 S248 M249 A250 H254
• Binding residue (residue number reindexed from 1): M30 F56 H60 F63 N64 W106 F107 G108 G109 S111 W146 M157 S158 M159 A160 H164

Enzymatic activity

• Enzyme Commision number: 3.4.21.105: rhomboid protease.

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:5mtf, PDBe:5mtf, PDBj:5mtf
• PDBsum: 5mtf
• PubMed: 29107700
• UniProt: P09391|GLPG_ECOLI Rhomboid protease GlpG (Gene Name=glpG)