Structure of PDB 5mpg Chain A Binding Site BS01

Receptor Information

>5mpg Chain A (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ASKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN
TKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQR

Ligand information

>5mpg Chain B (length=7) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uuagguc

.......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5mpg Tandem hnRNP A1 RNA recognition motifs act in concert to repress the splicing of survival motor neuron exon 7.
Resolution	N/A
Binding residue (original residue number in PDB)	A1 S2 K15 F17 G19 G20 L21 F23 D42 V44 M46 R55 G56 F57 F59 R82 E85 K87 A89 V90 R92 S95 R97
Binding residue (residue number reindexed from 1)	A1 S2 K15 F17 G19 G20 L21 F23 D42 V44 M46 R55 G56 F57 F59 R82 E85 K87 A89 V90 R92 S95 R97
Binding affinity	PDBbind-CN: Kd=292nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:5mpg, PDBe:5mpg, PDBj:5mpg
PDBsum	5mpg
PubMed	28650318
UniProt	P09651\|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 (Gene Name=HNRNPA1)

[Back to BioLiP]