Structure of PDB 5mp5 Chain A Binding Site BS01

Receptor Information
>5mp5 Chain A (length=218) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVQLQQSGPELVKPGTSVKMPCKASGYIFTDYVISWVKQRTGQGLEWIGE
IFPRSGSTYYNEKFKGKATLTADKSSNTAYMQLSSVTSEDSAVYFCARDY
YGTSFAMDYWGQGTSVTVSSAKTTPPSVYPLAPAAQTNSMVTLGCLVKGY
FPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTC
NVAHPASSTKVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mp5 Crystal structure of DC8E8 Fab in the complex with a 14-mer tau peptide at pH 6.5
Resolution2.31 Å
Binding residue
(original residue number in PDB)		E50 F52 S57 Y59 Y101 F105
Binding residue
(residue number reindexed from 1)		E50 F52 S57 Y59 Y101 F105
External links