Structure of PDB 5mp3 Chain A Binding Site BS01

Receptor Information
>5mp3 Chain A (length=220) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVQLQQSGPELVKPGTSVKMPCKASGYIFTDYVISWVKQRTGQGLEWIGE
IFPRSGSTYYNEKFKGKATLTADKSSNTAYMQLSSVTSEDSAVYFCARDY
YGTSFAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVK
GYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETV
TCNVAHPASSTKVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mp3 Crystal structure of DC8E8 Fab in the complex with a 30-mer tau peptide at pH 6.5
Resolution2.75 Å
Binding residue
(original residue number in PDB)
E50 F52 S57 Y59 Y101 F105
Binding residue
(residue number reindexed from 1)
E50 F52 S57 Y59 Y101 F105
Enzymatic activity
Enzyme Commision number ?
External links