Structure of PDB 5mhj Chain A Binding Site BS01

Receptor Information
>5mhj Chain A (length=194) Species: 10299 (Human alphaherpesvirus 1 strain 17) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDADATSGAFYARYRDGYVSGEPWPGAGPPPPGRVLYGGLGDSRPGLWGA
PEAEEARRRFEASGAPAAVWAPELGDAAQQYALITRLLYTPDAEAMGWLQ
NPRVVPGDVALDQACFRISGAARNSSSFITGSVARAVPHLGYAMAAGRFG
WGLAHAAAAVAMSRRYDRAQKGFLLTSLRRAYAPLLARENAALT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mhj The herpes viral transcription factor ICP4 forms a novel DNA recognition complex.
Resolution2.117 Å
Binding residue
(original residue number in PDB)		S418 R456 R457
Binding residue
(residue number reindexed from 1)		S126 R164 R165
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0045893 positive regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5mhj, PDBe:5mhj, PDBj:5mhj
PDBsum5mhj
PubMed28505309
UniProtP08392|ICP4_HHV11 Major viral transcription factor ICP4 (Gene Name=ICP4)

[Back to BioLiP]