Structure of PDB 5mfk Chain A Binding Site BS01

Receptor Information
>5mfk Chain A (length=239) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVK
LLDDASEEVIKEAVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEE
VIKEAVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWA
IANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGN
NEMKQKLEEAGALPALEKLQSHANEEVQKNAQAALEAFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mfk Curvature of designed armadillo repeat proteins allows modular peptide binding.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		S82 W117 N121 S124 G125 K155 E156 W159 N163 S166 W201 N205
Binding residue
(residue number reindexed from 1)		S72 W107 N111 S114 G115 K145 E146 W149 N153 S156 W191 N195
External links