Structure of PDB 5mfi Chain A Binding Site BS01

Receptor Information
>5mfi Chain A (length=239) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKL
LDDASEEVIQEAVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEV
IQEAVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAI
ANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNN
EQIQKLEEAGAEPALEKLQSSPNEEVQKNAQAALEALNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mfi Curvature of designed armadillo repeat proteins allows modular peptide binding.
Resolution1.45 Å
Binding residue
(original residue number in PDB)		G83 N84 N85 I88 N121 S124 G125 N126 N127 E156 W159 N163 S166 G167 N168 N169 I172 W201 N205 S208
Binding residue
(residue number reindexed from 1)		G72 N73 N74 I77 N110 S113 G114 N115 N116 E145 W148 N152 S155 G156 N157 N158 I161 W190 N194 S197
External links