Structure of PDB 5mf9 Chain A Binding Site BS01

Receptor Information
>5mf9 Chain A (length=64) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLY
WDGEKETYVPAAES
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mf9 Structural basis for the recognition ofspliceosomal SmN B B proteins by theRBM5 OCRE domain in splicing regulation
ResolutionN/A
Binding residue
(original residue number in PDB)		S21 Y23 Y32 Y33 D34 S37 Y39 Y41 Y48
Binding residue
(residue number reindexed from 1)		S21 Y23 Y32 Y33 D34 S37 Y39 Y41 Y48
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5mf9, PDBe:5mf9, PDBj:5mf9
PDBsum5mf9
PubMed27894420
UniProtP52756|RBM5_HUMAN RNA-binding protein 5 (Gene Name=RBM5)

[Back to BioLiP]