Structure of PDB 5mf0 Chain A Binding Site BS01

Receptor Information
>5mf0 Chain A (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNG
AHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYC
QYAFDLKCDSVCVNPYHYERVVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mf0 Structural basis for genome wide recognition of 5-bp GC motifs by SMAD transcription factors.
Resolution3.03 Å
Binding residue
(original residue number in PDB)		R38 T77 L78 L82 Q83 V84 A85 K88
Binding residue
(residue number reindexed from 1)		R23 T62 L63 L67 Q68 V69 A70 K73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005667 transcription regulator complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mf0, PDBe:5mf0, PDBj:5mf0
PDBsum5mf0
PubMed29234012
UniProtQ13485|SMAD4_HUMAN Mothers against decapentaplegic homolog 4 (Gene Name=SMAD4)

[Back to BioLiP]