Structure of PDB 5mez Chain A Binding Site BS01

Receptor Information
>5mez Chain A (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTN
GAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKY
CQYAFDLKCDSVCVNPYHYERVVSP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mez Structural basis for genome wide recognition of 5-bp GC motifs by SMAD transcription factors.
Resolution2.98 Å
Binding residue
(original residue number in PDB)		R38 T77 L78 L82 Q83 K88
Binding residue
(residue number reindexed from 1)		R24 T63 L64 L68 Q69 K74
Binding affinityPDBbind-CN: Kd=250nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005667 transcription regulator complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mez, PDBe:5mez, PDBj:5mez
PDBsum5mez
PubMed29234012
UniProtQ13485|SMAD4_HUMAN Mothers against decapentaplegic homolog 4 (Gene Name=SMAD4)

[Back to BioLiP]