Structure of PDB 5mcu Chain A Binding Site BS01

Receptor Information
>5mcu Chain A (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSVPSQKTYQGSYGFRLGFLHSGAKSVTCTYSPALNKMFCQLAKTCPVQL
WVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCDSDGLAPPQHLIR
VEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGM
NRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mcu New Insights into the Role of DNA Shape on Its Recognition by p53 Proteins.
Resolution1.7 Å
Binding residue
(original residue number in PDB)
S241 R248 R273 C275 A276 R280
Binding residue
(residue number reindexed from 1)
S145 R152 R177 C179 A180 R184
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006915 apoptotic process
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5mcu, PDBe:5mcu, PDBj:5mcu
PDBsum5mcu
PubMed30057026
UniProtP04637|P53_HUMAN Cellular tumor antigen p53 (Gene Name=TP53)

[Back to BioLiP]