Structure of PDB 5m8i Chain A Binding Site BS01

Receptor Information
>5m8i Chain A (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGSSHHHHHHSSGLVPRGSHMQKEGPEGANLFIYHLPQEFGDQDILQMFM
PFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRL
KVQLKRSKNDSKPW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5m8i Aromatic side-chain conformational switch on the surface of the RNA Recognition Motif enables RNA discrimination.
ResolutionN/A
Binding residue
(original residue number in PDB)		Q22 F32 Y34 H35 K59 F61 I62 K70 F72 F74 K98 K101 R106
Binding residue
(residue number reindexed from 1)		Q22 F32 Y34 H35 K59 F61 I62 K70 F72 F74 K98 K101 R106
Binding affinityPDBbind-CN: Kd=62uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5m8i, PDBe:5m8i, PDBj:5m8i
PDBsum5m8i
PubMed28935965
UniProtO95319|CELF2_HUMAN CUGBP Elav-like family member 2 (Gene Name=CELF2)

[Back to BioLiP]