Structure of PDB 5m72 Chain A Binding Site BS01

Receptor Information
>5m72 Chain A (length=150) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNG
SFKEALNVINTHTKVLANNSLSFEKAYCEYRLNRIENALKTIESANQQTD
KLKELYGQVLYRLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQS
Ligand information
>5m72 Chain B (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KPLFFDLALNHVAFPPLEDKL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5m72 Structures of human SRP72 complexes provide insights into SRP RNA remodeling and ribosome interaction.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		W15 V18 N19 D44 T46 H49 C50 V53 C54 F82 Y86 K110 E113 Q117 Y120 Y143 E146 R147 T149 N150
Binding residue
(residue number reindexed from 1)		W6 V9 N10 D35 T37 H40 C41 V44 C45 F73 Y77 K101 E104 Q108 Y111 Y134 E137 R138 T140 N141
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane

View graph for
Biological Process
External links
PDB RCSB:5m72, PDBe:5m72, PDBj:5m72
PDBsum5m72
PubMed27899666
UniProtO76094|SRP72_HUMAN Signal recognition particle subunit SRP72 (Gene Name=SRP72)

[Back to BioLiP]