Structure of PDB 5m5v Chain A Binding Site BS01

Receptor Information

>5m5v Chain A (length=360) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVII
DMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHT
MTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQI
INYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQ
FKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFP
PEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETI
FVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAV
RNNLAGAEEL

Ligand information

>5m5v Chain E (length=6) Species: 12475 (Hepatitis delta virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LPLLES

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5m5v Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin.
Resolution	1.96 Å
Binding residue (original residue number in PDB)	R64 P65 I66 S67 L82 K83 Q89 K96
Binding residue (residue number reindexed from 1)	R61 P62 I63 S64 L79 K80 Q86 K93

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005198	structural molecule activity

	Biological Process
GO:0006886	intracellular protein transport
GO:0016192	vesicle-mediated transport

	Cellular Component
GO:0030130	clathrin coat of trans-Golgi network vesicle
GO:0030132	clathrin coat of coated pit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5m5v, PDBe:5m5v, PDBj:5m5v
PDBsum	5m5v
PubMed	27813245
UniProt	P49951\|CLH1_BOVIN Clathrin heavy chain 1 (Gene Name=CLTC)

[Back to BioLiP]