Structure of PDB 5m02 Chain A Binding Site BS01

Receptor Information
>5m02 Chain A (length=275) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAP
WMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSG
CDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQS
GAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRKGEVTL
RCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPL
GKEQNYTCRVYHEGLPEPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5m02 Thernary complexes of TCR P14 give insights into the mechanisms behind reestablishment of CTL responses against a viral escape mutant
Resolution1.75 Å
Binding residue
(original residue number in PDB)
Y7 Y59 E63 K66 Q70 W73 V76 S77 N80 Y84 Q97 S99 F116 Y123 T143 K146 W147 H155 Y156 Y159 E163 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 Y59 E63 K66 Q70 W73 V76 S77 N80 Y84 Q97 S99 F116 Y123 T143 K146 W147 H155 Y156 Y159 E163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5m02, PDBe:5m02, PDBj:5m02
PDBsum5m02
PubMed
UniProtP01899|HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain (Gene Name=H2-D1)

[Back to BioLiP]