Structure of PDB 5lvf Chain A Binding Site BS01

Receptor Information
>5lvf Chain A (length=142) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAFSSEQFTTKLNTLEDSQESISSASKWLLLQYRDAPKVAEMWKEYMLRP
SVNTRRKLLGLYLMNHVVQQAKGQKIIQFQDSFGKVAAEVLGRINQEFPR
DLKKKLSRVVNILKERNIFSKQVVNDIERSLAAALEHHHHHH
Ligand information
>5lvf Chain B (length=16) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PSYSPTSPSYSPTSPS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lvf Structural insight into recognition of phosphorylated threonine-4 of RNA polymerase II C-terminal domain by Rtt103p.
ResolutionN/A
Binding residue
(original residue number in PDB)		E16 D17 S18 Q19 I22 Y62 N65 H66 Q69 Q70 K72 G73 K75 R108 I112 R116
Binding residue
(residue number reindexed from 1)		E16 D17 S18 Q19 I22 Y62 N65 H66 Q69 Q70 K72 G73 K75 R108 I112 R116
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0099122 RNA polymerase II C-terminal domain binding
Biological Process
GO:0031124 mRNA 3'-end processing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5lvf, PDBe:5lvf, PDBj:5lvf
PDBsum5lvf
PubMed28468956
UniProtQ05543|RT103_YEAST Regulator of Ty1 transposition protein 103 (Gene Name=RTT103)

[Back to BioLiP]