Structure of PDB 5lso Chain A Binding Site BS01

Receptor Information
>5lso Chain A (length=103) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMGKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGA
PDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDL
AEQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lso Rational Design of Cyclic Peptide Inhibitors of U2AF Homology Motif (UHM) Domains To Modulate Pre-mRNA Splicing.
Resolution2.22 Å
Binding residue
(original residue number in PDB)		M312 D319 E325 E329 L372 R375 Y376 F377 G378 G379
Binding residue
(residue number reindexed from 1)		M15 D22 E28 E32 L75 R78 Y79 F80 G81 G82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0045292 mRNA cis splicing, via spliceosome

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5lso, PDBe:5lso, PDBj:5lso
PDBsum5lso
PubMed27753493
UniProtQ96I25|SPF45_HUMAN Splicing factor 45 (Gene Name=RBM17)

[Back to BioLiP]