Structure of PDB 5lrs Chain A Binding Site BS01

Receptor Information

>5lrs Chain A (length=236) Species: 1639 (Listeria monocytogenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSI
SENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINE
LKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILT
YVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVY
KNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN

Ligand information

>5lrs Chain C (length=30) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttgaggcattaacatttgttaacgacgata

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5lrs Structural basis for glutathione-mediated activation of the virulence regulatory protein PrfA in Listeria.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	M171 S187 S191 K194
Binding residue (residue number reindexed from 1)	M170 S186 S190 K193

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5lrs, PDBe:5lrs, PDBj:5lrs
PDBsum	5lrs
PubMed	27930316
UniProt	P22262\|PRFA_LISMO Listeriolysin regulatory protein (Gene Name=prfA)

[Back to BioLiP]