Structure of PDB 5ljn Chain A Binding Site BS01

Receptor Information
>5ljn Chain A (length=173) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDA
ARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNP
VFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEV
LLLRTELSLLLQNTHPRQQALEQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ljn SPATA2 Links CYLD to LUBAC, Activates CYLD, and Controls LUBAC Signaling.
Resolution2.701 Å
Binding residue
(original residue number in PDB)		Y82 N85 P92 Y94 G97 V98 K99 N101 N102 V104
Binding residue
(residue number reindexed from 1)		Y79 N82 P89 Y91 G94 V95 K96 N98 N99 V101
Enzymatic activity
Enzyme Commision number 2.3.2.31: RBR-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
Cellular Component
GO:0071797 LUBAC complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5ljn, PDBe:5ljn, PDBj:5ljn
PDBsum5ljn
PubMed27591049
UniProtQ96EP0|RNF31_HUMAN E3 ubiquitin-protein ligase RNF31 (Gene Name=RNF31)

[Back to BioLiP]