Structure of PDB 5li1 Chain A Binding Site BS01

Receptor Information
>5li1 Chain A (length=334) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDED
IDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQ
RQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLT
DYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFE
MMAGRSPFDITEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERL
GCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQ
FTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLL
Ligand information
>5li1 Chain B (length=20) Species: 8364 (Xenopus tropicalis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LAFQREGFGRQSMSEKRTKQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5li1 aPKC Inhibition by Par3 CR3 Flanking Regions Controls Substrate Access and Underpins Apical-Junctional Polarization.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
S264 Y265 E294 D295 W298 D339 M341 M344 D378 K380 G398 M399 T412 F413 C414 G415 T416 P417 N418 Y419 E445 G449 R450 T466 E467 F556
Binding residue
(residue number reindexed from 1)
S19 Y20 E49 D50 W53 D94 M96 M99 D133 K135 G153 M154 T167 F168 C169 G170 T171 P172 N173 Y174 E200 G204 R205 T211 E212 F301
Enzymatic activity
Catalytic site (original residue number in PDB) D378 K380 N383 D396 T416
Catalytic site (residue number reindexed from 1) D133 K135 N138 D151 T171
Enzyme Commision number 2.7.11.13: protein kinase C.
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005524 ATP binding
Biological Process
GO:0006468 protein phosphorylation
GO:0007163 establishment or maintenance of cell polarity

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:5li1, PDBe:5li1, PDBj:5li1
PDBsum5li1
PubMed27554858
UniProtP41743|KPCI_HUMAN Protein kinase C iota type (Gene Name=PRKCI)

[Back to BioLiP]