Structure of PDB 5li1 Chain A Binding Site BS01

Receptor Information

>5li1 Chain A (length=334) Species: 9606 (Homo sapiens)

SFSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDED
IDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQ
RQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLT
DYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFE
MMAGRSPFDITEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERL
GCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQ
FTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLL

Ligand information

>5li1 Chain B (length=20) Species: 8364 (Xenopus tropicalis)

LAFQREGFGRQSMSEKRTKQ

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5li1 aPKC Inhibition by Par3 CR3 Flanking Regions Controls Substrate Access and Underpins Apical-Junctional Polarization.
• Resolution: 2.0 Å
• Binding residue (original residue number in PDB): S264 Y265 E294 D295 W298 D339 M341 M344 D378 K380 G398 M399 T412 F413 C414 G415 T416 P417 N418 Y419 E445 G449 R450 T466 E467 F556
• Binding residue (residue number reindexed from 1): S19 Y20 E49 D50 W53 D94 M96 M99 D133 K135 G153 M154 T167 F168 C169 G170 T171 P172 N173 Y174 E200 G204 R205 T211 E212 F301

Enzymatic activity

• Catalytic site (original residue number in PDB): D378 K380 N383 D396 T416
• Catalytic site (residue number reindexed from 1): D133 K135 N138 D151 T171
• Enzyme Commision number: 2.7.11.13: protein kinase C.

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004674 protein serine/threonine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation
• GO:0007163 establishment or maintenance of cell polarity

External links

• PDB: RCSB:5li1, PDBe:5li1, PDBj:5li1
• PDBsum: 5li1
• PubMed: 27554858
• UniProt: P41743|KPCI_HUMAN Protein kinase C iota type (Gene Name=PRKCI)