Structure of PDB 5leo Chain A Binding Site BS01

Receptor Information
>5leo Chain A (length=93) Species: 90964 (Staphylococcaceae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GWKTNKYGTLYKSESASFTPNTDIITRTTGPFRSMPQSGVLKAGQTIHYD
EVMKQDGHVWVGYTGNSGQRIYLPVRTWNKSTNTLGVLWGTIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5leo Complex structure of lysostaphin SH3doamin with peptidoglycan fragment
Resolution1.6 Å
Binding residue
(original residue number in PDB)
N405 Y407 Y411 T429 P431 F432 M435 E451 M453 Y472
Binding residue
(residue number reindexed from 1)
N5 Y7 Y11 T29 P31 F32 M35 E51 M53 Y72
Enzymatic activity
Enzyme Commision number 3.4.24.75: lysostaphin.
External links
PDB RCSB:5leo, PDBe:5leo, PDBj:5leo
PDBsum5leo
PubMed
UniProtP10547|LSTP_STASI Lysostaphin (Gene Name=lss)

[Back to BioLiP]